ACTL7A Polyclonal antibody

• 

  WB analysis using 17355-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17355-1-AP (ACTL7A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 17355-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17355-1-AP (ACTL7A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 17355-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17355-1-AP (ACTL7A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ACTL7A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17355-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Actin like 7 alpha, actin like 7A, Actin like protein 7A, ACTL7A

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IHC: See 1 publications below
• IF: See 11 publications below
• IP: See 2 publications below
• CoIP: See 3 publications below

Product Information

17355-1-AP targets ACTL7A in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10613

  Product name: Recombinant human ACTL7A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-280 aa of BC014610

  Sequence: MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCC

• Full Name: actin-like 7A
• Calculated Molecular Weight: 435 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC014610
• Gene Symbol: ACTL7A
• Gene ID (NCBI): 10881
• RRID: AB_2273677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y615
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACTL7a is located in the acrosome and tail of mature spermatozoa and plays an important role in spermiogenesis. Recently mutation of ACTL7A has been linked to infertility.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF,CoIP	Am J Hum Genet; Homozygous pathogenic variants in ACTL9 cause fertilization failure and male infertility in humans and mice.; Authors - Jing Dai
human	WB,IF	Hum Reprod; ACROSIN deficiency causes total fertilization failure in humans by preventing the sperm from penetrating the zona pellucida; Authors - Rong Hua
human	WB,IF	Hum Reprod; Deletion of ACTRT1 is associated with male infertility as sperm acrosomal ultrastructural defects and fertilization failure in human; Authors - Qi Zhang
human	CoIP	Hum Reprod; Loss of SPACA1 function causes autosomal recessive globozoospermia by damaging the acrosome-acroplaxome complex.; Authors - Pingping Chen
human	WB,IF	Hum Reprod; Novel bi-allelic variants in ACTL7A are associated with male infertility and total fertilization failure.; Authors - Jing Wang
human,mouse	WB,IF,IP	Development; Loss of perinuclear theca ACTRT1 causes acrosome detachment and severe male subfertility in mice.; Authors - Xiao-Zhen Zhang