ACTL7A Polyclonal antibody

ACTL7A Polyclonal Antibody for WB, IHC, ELISA
Cat No. 17355-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Actin like 7 alpha, actin like 7A, Actin like protein 7A, ACTL7A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, rat testis tissue
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17355-1-AP targets ACTL7A in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10613

Product name: Recombinant human ACTL7A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-280 aa of BC014610

Sequence: MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCC

Predict reactive species
Full Name actin-like 7A
Calculated Molecular Weight 435 aa, 49 kDa
Observed Molecular Weight 49 kDa
GenBank Accession NumberBC014610
Gene Symbol ACTL7A
Gene ID (NCBI) 10881
RRIDAB_2273677
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y615
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACTL7a is located in the acrosome and tail of mature spermatozoa and plays an important role in spermiogenesis. Recently mutation of ACTL7A has been linked to infertility.

Protocols

Product Specific Protocols
IHC protocol for ACTL7A antibody 17355-1-APDownload protocol
WB protocol for ACTL7A antibody 17355-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF,CoIP

Am J Hum Genet

Homozygous pathogenic variants in ACTL9 cause fertilization failure and male infertility in humans and mice.

Authors - Jing Dai
humanWB,IF

Hum Reprod

ACROSIN deficiency causes total fertilization failure in humans by preventing the sperm from penetrating the zona pellucida

Authors - Rong Hua
humanWB,IF

Hum Reprod

Deletion of ACTRT1 is associated with male infertility as sperm acrosomal ultrastructural defects and fertilization failure in human

Authors - Qi Zhang
humanCoIP

Hum Reprod

Loss of SPACA1 function causes autosomal recessive globozoospermia by damaging the acrosome-acroplaxome complex.

Authors - Pingping Chen
humanWB,IF

Hum Reprod

Novel bi-allelic variants in ACTL7A are associated with male infertility and total fertilization failure.

Authors - Jing Wang
human,mouseWB,IF,IP

Development

Loss of perinuclear theca ACTRT1 causes acrosome detachment and severe male subfertility in mice.

Authors - Xiao-Zhen Zhang
Loading...
||
New chat Able
正在加载,请稍候...