ACTN2 Polyclonal antibody

ACTN2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA
Cat No. 14221-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA

Actinin alpha 2, actinin, alpha 2, ACTN 2, Alpha actinin 2, Alpha-actinin skeletal muscle isoform 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, C2C12 cells, mouse lung tissue, mouse skeletal muscle tissue, mouse heart, mouse kidney, rat skeletal muscle
Positive IP detected inHeLa cells
Positive IHC detected inmouse heart tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue
Positive IF-Fro detected inmouse heart tissue
Positive IF/ICC detected inC2C12 cells, NIH/3T3 cells, Human iPSC derived cardiomyocyte

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14221-1-AP targets ACTN2 in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5459

Product name: Recombinant human ACTN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-301 aa of BC051770

Sequence: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI

Predict reactive species
Full Name actinin, alpha 2
Calculated Molecular Weight 104 kDa
Observed Molecular Weight 103 kDa
GenBank Accession NumberBC051770
Gene Symbol ACTN2
Gene ID (NCBI) 88
RRIDAB_2221547
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35609
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha actinin 2 (ACTN2) belongs to the alpha-actinin family and is expressed in both skeletal and cardiac muscles and functions to anchor myofibrillar actin thin filaments and titin to Z-discs (PMID: 30701273). ACTN2 is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Mutations in ACTN2 are associated with hypertrophic cardiomyopathy, as well as dilated cardiomyopathy and endocardial fibroelastosis (PMID: 20022194, 14567970).

Protocols

Product Specific Protocols
WB protocol for ACTN2 antibody 14221-1-APDownload protocol
IHC protocol for ACTN2 antibody 14221-1-APDownload protocol
IF protocol for ACTN2 antibody 14221-1-APDownload protocol
IP protocol for ACTN2 antibody 14221-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat

Adv Mater

Exoskeleton Partial-Coated Stem Cells for Infarcted Myocardium Restoring

Authors - Huihui He
mouseWB,IF

Nat Commun

Microskeletal stiffness promotes aortic aneurysm by sustaining pathological vascular smooth muscle cell mechanosensation via Piezo1.

Authors - Weiyi Qian
ratWB

Basic Res Cardiol

Alkaline nucleoplasm facilitates contractile gene expression in the mammalian heart.

Authors - Alzbeta Hulikova
humanIF

Dev Cell

Essential role of MESP1-RING1A complex in cardiac differentiation

Authors - Qianqian Liang
humanIF

Front Cell Dev Biol

Targeting of CAT and VCAM1 as Novel Therapeutic Targets for DMD Cardiomyopathy.

Authors - Bin Li
humanWB,IF

Front Cell Dev Biol

Incomplete Assembly of the Dystrophin-Associated Protein Complex in 2D and 3D-Cultured Human Induced Pluripotent Stem Cell-Derived Cardiomyocytes.

Authors - Guillaume Gilbert

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Rebecca (Verified Customer) (09-21-2022)

20ug of protein was loaded. Transference at 4ºC and 90V, for 2h. Antibody incubation ON at 4ºC.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: iPSC-CM
ACTN2 Antibody Western Blot validation (1:10000 dilution) in iPSC-CM (Cat no:14221-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...