Tested Applications
| Positive WB detected in | mouse brain tissue, C2C12 cells, mouse lung tissue, mouse skeletal muscle tissue, mouse heart, mouse kidney, rat skeletal muscle |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse heart tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
| Positive IF-Fro detected in | mouse heart tissue |
| Positive IF/ICC detected in | C2C12 cells, NIH/3T3 cells, Human iPSC derived cardiomyocyte |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14221-1-AP targets ACTN2 in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, canine, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5459 Product name: Recombinant human ACTN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC051770 Sequence: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI Predict reactive species |
| Full Name | actinin, alpha 2 |
| Calculated Molecular Weight | 104 kDa |
| Observed Molecular Weight | 103 kDa |
| GenBank Accession Number | BC051770 |
| Gene Symbol | ACTN2 |
| Gene ID (NCBI) | 88 |
| RRID | AB_2221547 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35609 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha actinin 2 (ACTN2) belongs to the alpha-actinin family and is expressed in both skeletal and cardiac muscles and functions to anchor myofibrillar actin thin filaments and titin to Z-discs (PMID: 30701273). ACTN2 is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Mutations in ACTN2 are associated with hypertrophic cardiomyopathy, as well as dilated cardiomyopathy and endocardial fibroelastosis (PMID: 20022194, 14567970).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACTN2 antibody 14221-1-AP | Download protocol |
| IHC protocol for ACTN2 antibody 14221-1-AP | Download protocol |
| IP protocol for ACTN2 antibody 14221-1-AP | Download protocol |
| WB protocol for ACTN2 antibody 14221-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACTN2 polyclonal antibody (catalog number 14221-1-AP) has accumulated 42 citations published in journals such as Nature Communications, Advanced Materials, EMBO Molecular Medicine, Developmental Cell, Journal of Molecular and Cellular Cardiology, Biomaterials, Aging Cell, and Acta Pharmaceutica Sinica B. The associated research fields include cardiomyopathy, cardiac differentiation, sarcomere biology, myocardial infarction, cardiac hypertrophy, stem cell-based therapy, and muscle physiology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting intracellular cholesterol imbalance rescues sarcomere-ER contact site signaling and ER remodeling in dilated cardiomyopathy. | ||
Nat Commun Microskeletal stiffness promotes aortic aneurysm by sustaining pathological vascular smooth muscle cell mechanosensation via Piezo1. | ||
Acta Pharm Sin B Parkin inhibits iron overload-induced cardiomyocyte ferroptosis by ubiquitinating ACSL4 and modulating PUFA-phospholipids metabolism | ||
Cell Rep Med Phase 1/2 trial of brogidirsen: Dual-targeting antisense oligonucleotides for exon 44 skipping in Duchenne muscular dystrophy |
Reviews
What customers say
Both reviewers gave 5-star ratings. One user reported successful immunofluorescence on mouse heart tissue using PFA-fixed paraffin-embedded sections at 1:200 dilution with citrate buffer antigen retrieval. The other achieved good Western blot results on iPSC-derived cardiomyocytes at a 1:10,000 dilution, loading 20 µg of protein with overnight incubation at 4 °C. Overall, users report reliable performance across applications with clear, specific signals.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sian (Verified Customer) (09-24-2026) | Good results for IF on mouse heart tissue, PFA fixed paraffin embedded sections, 7microns thick ,with citrate buffer antigen retrieval.
![]() |
Rebecca (Verified Customer) (09-21-2022) | 20ug of protein was loaded. Transference at 4ºC and 90V, for 2h. Antibody incubation ON at 4ºC.
![]() |

































