ACYP1 Polyclonal antibody

• 

  WB analysis using 13433-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13433-1-AP (ACYP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 13433-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13433-1-AP (ACYP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 13433-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 13433-1-AP (ACYP1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

ACYP1 Polyclonal Antibody for WB, ELISA

Cat No. 13433-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Acylphosphatase 1, ACYP1, ACYPE

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue, human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

13433-1-AP targets ACYP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4237

  Product name: Recombinant human ACYP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC035568

  Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK

• Full Name: acylphosphatase 1, erythrocyte (common) type
• Calculated Molecular Weight: 99 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC035568
• Gene Symbol: ACYP1
• Gene ID (NCBI): 97
• RRID: AB_2242288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07311
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IP	Drug Resist Updat; Targeting ACYP1-mediated glycolysis reverses lenvatinib resistance and restricts hepatocellular carcinoma progression; Authors - Shuai Wang ; KD Validated
human	WB	Int Immunopharmacol; Pterostilbene suppresses the growth of esophageal squamous cell carcinoma by inhibiting glycolysis and PKM2/STAT3/c-MYC signaling pathway; Authors - Yi Yang