Tested Applications
Positive WB detected in | mouse testis tissue, rat testis tissue, human brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IHC | See 1 publications below |
IP | See 1 publications below |
Product Information
13433-1-AP targets ACYP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4237 Product name: Recombinant human ACYP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC035568 Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK Predict reactive species |
Full Name | acylphosphatase 1, erythrocyte (common) type |
Calculated Molecular Weight | 99 aa, 11 kDa |
Observed Molecular Weight | 11 kDa |
GenBank Accession Number | BC035568 |
Gene Symbol | ACYP1 |
Gene ID (NCBI) | 97 |
RRID | AB_2242288 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P07311 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ACYP1 antibody 13433-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Drug Resist Updat Targeting ACYP1-mediated glycolysis reverses lenvatinib resistance and restricts hepatocellular carcinoma progression
| ||
Int Immunopharmacol Pterostilbene suppresses the growth of esophageal squamous cell carcinoma by inhibiting glycolysis and PKM2/STAT3/c-MYC signaling pathway |