• Featured Product
  • KD/KO Validated

ADAM12 Polyclonal antibody

ADAM12 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 14139-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

ADAM 12, Disintegrin and metalloproteinase domain-containing protein 12, EC:3.4.24.-, MCMP, Meltrin-alpha

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HeLa cells, mouse heart tissue, rat brain tissue, MCF-7 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman placenta tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14139-1-AP targets ADAM12 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5206

Product name: Recombinant human ADAM12 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 31-350 aa of BC060804

Sequence: VSLWNQGRADEVVSASVRSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELG

Predict reactive species
Full Name ADAM metallopeptidase domain 12
Calculated Molecular Weight 100 kDa
Observed Molecular Weight 90-100 kDa, 70-80 kDa
GenBank Accession NumberBC060804
Gene Symbol ADAM12
Gene ID (NCBI) 8038
RRIDAB_2289230
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43184
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADAM12, also named as MLTN and Meltrin-alpha, is involved in skeletal muscle regeneration, specifically at the onset of cell fusion. It is also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. ADAM12 is expressed in human malignant tumors(PMID:17355265). ADAM12's ability to degrade extracellular matrix components likely allows it to detach cancer cells from the basement membrane and assist them on their route to metastasis. But the protein's role not just as a biomarker of breast cancer but as a gateway to cancer cell migration is only now being understood. ADAM12 has 2 isoforms with the calculated molecular mass of 100 and 80 kDa, and this antibody can recognize all isoforms of ADAM12. ADAM12 has 4 forms: 120kDa full-length form, 90kd mature (processed form that lack the prodomain), 50-68kDa degradation product and 27kDa prodomain.

Protocols

Product Specific Protocols
WB protocol for ADAM12 antibody 14139-1-APDownload protocol
IHC protocol for ADAM12 antibody 14139-1-APDownload protocol
IF protocol for ADAM12 antibody 14139-1-APDownload protocol
IP protocol for ADAM12 antibody 14139-1-APDownload protocol
FC protocol for ADAM12 antibody 14139-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanIF

Cell Stem Cell

Vaccination-based immunotherapy to target profibrotic cells in liver and lung

Authors - Michal Sobecki
humanIHC

J Cell Biol

Notch increases the shedding of HB-EGF by ADAM12 to potentiate invadopodia formation in hypoxia.

Authors - Díaz Bego?a B

Matrix Biol

Antibodies and methods for immunohistochemistry of extracellular matrix proteins.

Authors - Steffen Rickelt
humanIF

Theranostics

Dysregulation of interaction between LOXhigh fibroblast and smooth muscle cells contributes to the pathogenesis of aortic dissection.

Authors - Yinan Chen
humanWB,IF

Cell Death Differ

ADAM12-directed ectodomain shedding of E-cadherin potentiates trophoblast fusion.

Authors - M Aghababaei
humanIHC

J Hematol Oncol

Aspartate β-hydroxylase promotes pancreatic ductal adenocarcinoma metastasis through activation of SRC signaling pathway.

Authors - Kosuke Ogawa
Loading...
||
New chat Able
正在加载,请稍候...