Product Information
84292-1-PBS targets ADAM17 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32418 Product name: Recombinant human ADAM17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 693-824 aa of BC136783 Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC Predict reactive species |
| Full Name | ADAM metallopeptidase domain 17 |
| Calculated Molecular Weight | 824 aa, 93 kDa |
| GenBank Accession Number | BC136783 |
| Gene Symbol | ADAM17 |
| Gene ID (NCBI) | 6868 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P78536 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

