ADAMTS7 Polyclonal antibody, PBS Only

• 

  WB analysis using 26836-1-AP (same clone as 26836-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26836-1-AP (ADAMTS7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26836-1-AP (same clone as 26836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26836-1-AP (ADAMTS7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26836-1-AP (same clone as 26836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26836-1-AP (ADAMTS7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26836-1-AP (same clone as 26836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26836-1-AP (ADAMTS7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26836-1-AP (same clone as 26836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26836-1-AP (ADAMTS7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26836-1-PBS in a different storage buffer formulation.

ADAMTS7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26836-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26836-1-PBS targets ADAMTS7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25218

  Product name: Recombinant human ADAMTS7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1507-1686 aa of BC061631

  Sequence: PAKPPAHRPCGAQPCLSWYTSSWRECSEACGGGEQQRLVTCPEPGLCEEALRPNTTRPCNTHPCTQWVVGPWGQCSGPCGGGVQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR

• Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 7
• Calculated Molecular Weight: 1686 aa, 184 kDa
• Observed Molecular Weight: 184 kDa
• GenBank Accession Number: BC061631
• Gene Symbol: ADAMTS7
• Gene ID (NCBI): 11173
• RRID: AB_2880653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKP4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.