ADPGK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ADPGK Polyclonal antibody (15639-1-AP)

ADPGK Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15639-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RbBP 35, PSEC0260, EC:2.7.1.147, ADP-GK, ADP-dependent glucokinase

• 

  WB analysis using 15639-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15639-1-AP (ADPGK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15639-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15639-1-AP (ADPGK antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15639-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15639-1-AP (ADPGK antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15639-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ADPGK antibody (15639-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ADPGK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, MOLT-4 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15639-1-AP targets ADPGK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8105

  Product name: Recombinant human ADPGK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 148-497 aa of BC006112

  Sequence: EFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY

• Full Name: ADP-dependent glucokinase
• Calculated Molecular Weight: 497 aa, 54 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC006112
• Gene Symbol: ADPGK
• Gene ID (NCBI): 83440
• RRID: AB_2224911
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRR6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADP-dependent glucokinase (ADPGK) has frst been described 1994 in hyperthermophilic archaea as a novel glucose-phosphorylating enzyme dependent on ADP (adenosine diphosphate) instead of ATP (adenosine triphosphate). Highest ADPGK expression is found in immune cells of both myeloid and lymphoid lineages. Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency (By similarity).

Publications

What published studies show

The ADPGK Polyclonal antibody (Cat# 15639-1-AP) has 7 total citations across journals including Biomaterials, Oncogenesis, Frontiers in Molecular Neuroscience, Journal of Clinical Immunology, and Frontiers in Oncology. Research fields span tumor immunotherapy, lung adenocarcinoma glycolysis, nerve injury macrophage phagocytosis, G6PC3 deficiency, and clear cell renal cell carcinoma biomarker discovery.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Biomaterials; P-Pev: micelle-like complexes transformed from tumor extracellular vesicles by PEG-PE for personalized therapeutic tumor vaccine; Authors - Hongjian Tian
human	WB	Oncogenesis; Inhibition of ZBTB7B-mediated ADPGK transcription by NEDD4 impedes glycolysis and progression of lung adenocarcinoma.; Authors - Fang-Peng Liu ; KD Validated
human	WB, IF	Front Mol Neurosci; Quantitative Proteomic Analysis of Mouse Sciatic Nerve Reveals Post-injury Upregulation of ADP-Dependent Glucokinase Promoting Macrophage Phagocytosis.; Authors - Kai Zhang
human	WB	J Clin Immunol; Molecular and Clinical Characterization of a Founder Mutation Causing G6PC3 Deficiency; Authors - Xin Zhen
human	WB	Front Oncol; Machine learning-based analysis identifies glucose metabolism-related genes ADPGK as potential diagnostic biomarkers for clear cell renal cell carcinoma.; Authors - Tie Li ; KD Validated
human	WB	Res Sq; Molecular and clinical characterization of a founder mutation causing G6PC3 deficiency; Authors - Xin Zhen