ADPGK Monoclonal antibody, PBS Only

• 

  WB analysis using 68034-1-Ig (same clone as 68034-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68034-1-Ig (ADPGK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68034-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 68034-1-Ig (same clone as 68034-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68034-1-Ig (ADPGK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68034-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 68034-1-Ig (same clone as 68034-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 68034-1-Ig (ADPGK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68034-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68034-1-Ig (same clone as 68034-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 68034-1-Ig (ADPGK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68034-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 68034-1-Ig (same clone as 68034-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 68034-1-Ig (ADPGK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68034-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 68034-1-Ig (same clone as 68034-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 68034-1-Ig (ADPGK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68034-1-PBS in a different storage buffer formulation.

ADPGK Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68034-1-PBS

Clone No.2B4B8

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

2610017G09Rik, ADP dependent glucokinase, ADP GK, ADPGK, DKFZp434B195, RbBP 35

---

Product Information

68034-1-PBS targets ADPGK in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31242

  Product name: Recombinant human ADPGK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 362-497 aa of BC006112

  Sequence: ILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY

• Full Name: ADP-dependent glucokinase
• Calculated Molecular Weight: 497 aa, 54 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC006112
• Gene Symbol: ADPGK
• Gene ID (NCBI): 83440
• RRID: AB_2918776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRR6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADP-dependent glucokinase (ADPGK) has frst been described 1994 in hyperthermophilic archaea as a novel glucose-phosphorylating enzyme dependent on ADP (adenosine diphosphate) instead of ATP (adenosine triphosphate). Highest ADPGK expression is found in immune cells of both myeloid and lymphoid lineages. Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency (By similarity).