AGAP3 Polyclonal antibody

• 

  WB analysis using 27681-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27681-1-AP (AGAP3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

AGAP3 Polyclonal Antibody for WB, ELISA

Cat No. 27681-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

AGAP-3, Centaurin gamma 3, CENTG3, CRAG, MRIP-1

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27681-1-AP targets AGAP3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26662

  Product name: Recombinant human AGAP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 474-556 aa of BC044644

  Sequence: LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT

• Full Name: ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC044644
• Gene Symbol: AGAP3
• Gene ID (NCBI): 116988
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P47
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AGAP3, also known as MRIP-1, CENTG3, contains multiple signaling domains, a GTPase-like domain, a pleckstrin homology domain, and an ArfGAP domain, and exists as a component of the NMDA receptor complex. AGAP3 is a component of the NMDA receptor complex that regulates Arf6 and Ras/ERK signaling (PMID: 23904596).