AHR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AHR Polyclonal antibody (28727-1-AP)

• Featured Product
• KD/KO Validated

AHR Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 28727-1-AP

Publications(54)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

Ah receptor, bHLHe76, Class E basic helix-loop-helix protein 76

• 

  WB analysis using 28727-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28727-1-AP (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 28727-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28727-1-AP (AHR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 28727-1-AP

  WB result of AHR antibody (28727-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AHR transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of PC-3 using 28727-1-AP

  IP result of anti-AHR (IP:28727-1-AP, 4ug; Detection:28727-1-AP 1:5000) with PC-3 cells lysate 1480 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 28727-1-AP

  IP result of anti-AHR (IP:28727-1-AP, 4ug; Detection:28727-1-AP 1:5000) with HepG2 cells lysate 1360 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 28727-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28727-1-AP (AHR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 28727-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using AHR antibody (28727-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells
• Positive IP detected in: PC-3 cells, HepG2 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28727-1-AP targets AHR in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28935

  Product name: Recombinant human AHR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-300 aa of BC070080

  Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC

• Full Name: aryl hydrocarbon receptor
• Calculated Molecular Weight: 848 aa, 96 kDa
• Observed Molecular Weight: 105-110 kDa
• GenBank Accession Number: BC070080
• Gene Symbol: AHR
• Gene ID (NCBI): 196
• RRID: AB_2918196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35869
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Biomaterials; Biomimetic nanoplatform with microbiome modulation and antioxidant functions ameliorating insulin resistance and pancreatic β-cell dysfunction for T2DM management; Authors - Xiudan Wang
	IP,ChIP	NPJ Regen Med; Aryl hydrocarbon receptor regulates IL-22 receptor expression on thymic epithelial cell and accelerates thymus regeneration; Authors - Jingyi Shen
human	WB,IF,ChIP	Cell Death Discov; IDO1 inhibits ferroptosis by regulating FTO-mediated m6A methylation and SLC7A11 mRNA stability during glioblastoma progression; Authors - Qianting Tian
	WB	J Agric Food Chem; Fructo-oligosaccharides Alleviated Ulcerative Colitis via Gut Microbiota-Dependent Tryptophan Metabolism in Association with Aromatic Hydrocarbon Receptor Activation in Mice; Authors - Chengcheng Yang
human	WB,IF	Biochem Pharmacol; Molecular Dissection of the AHR-AREG driven EGFR-ERK1/2-CyclinD1 axis in acquired lenvatinib resistance of Hepatocellular carcinoma; Authors - Yuelei Hu
human	WB,ChIP	Biochem Pharmacol; IDO1-mediated AhR activation up-regulates pentose phosphate pathway via NRF2 to inhibit ferroptosis in lung cancer; Authors - Jiani Zhan