Tested Applications
| Positive WB detected in | A431 cells, HepG2 cells |
| Positive IP detected in | PC-3 cells, HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 34 publications below |
| IHC | See 6 publications below |
| IF | See 14 publications below |
| IP | See 5 publications below |
| ChIP | See 4 publications below |
Product Information
28727-1-AP targets AHR in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28935 Product name: Recombinant human AHR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-300 aa of BC070080 Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC Predict reactive species |
| Full Name | aryl hydrocarbon receptor |
| Calculated Molecular Weight | 848 aa, 96 kDa |
| Observed Molecular Weight | 105-110 kDa |
| GenBank Accession Number | BC070080 |
| Gene Symbol | AHR |
| Gene ID (NCBI) | 196 |
| RRID | AB_2918196 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35869 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AHR antibody 28727-1-AP | Download protocol |
| IHC protocol for AHR antibody 28727-1-AP | Download protocol |
| IP protocol for AHR antibody 28727-1-AP | Download protocol |
| WB protocol for AHR antibody 28727-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biomaterials Biomimetic nanoplatform with microbiome modulation and antioxidant functions ameliorating insulin resistance and pancreatic β-cell dysfunction for T2DM management | ||
NPJ Regen Med Aryl hydrocarbon receptor regulates IL-22 receptor expression on thymic epithelial cell and accelerates thymus regeneration | ||
Cell Death Discov IDO1 inhibits ferroptosis by regulating FTO-mediated m6A methylation and SLC7A11 mRNA stability during glioblastoma progression | ||
J Agric Food Chem Fructo-oligosaccharides Alleviated Ulcerative Colitis via Gut Microbiota-Dependent Tryptophan Metabolism in Association with Aromatic Hydrocarbon Receptor Activation in Mice | ||
Biochem Pharmacol Molecular Dissection of the AHR-AREG driven EGFR-ERK1/2-CyclinD1 axis in acquired lenvatinib resistance of Hepatocellular carcinoma | ||
Biochem Pharmacol IDO1-mediated AhR activation up-regulates pentose phosphate pathway via NRF2 to inhibit ferroptosis in lung cancer |













