AHR Polyclonal antibody

• 

  WB analysis using 30242-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30242-1-AP (AHR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 30242-1-AP

  WB result of AHR antibody (30242-1-AP; 1:1000; room temperature for 1.5 hours) with wild-type and AHR knockout A549 cells.

• 

  IHC staining of human ovary cancer using 30242-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30242-1-AP (AHR antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 30242-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30242-1-AP (AHR antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

AHR Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30242-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Ah receptor, bHLHe76, Class E basic helix-loop-helix protein 76

---

Tested Applications

• Positive WB detected in: HepG2 cells, A549 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30242-1-AP targets AHR in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32335

  Product name: Recombinant human AHR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 637-848 aa of BC070080

  Sequence: QLCQKMKHMQVNGMFENWNSNQFVPFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYPMGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFPDLTSSGFL

• Full Name: aryl hydrocarbon receptor
• Calculated Molecular Weight: 848 aa, 96 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC070080
• Gene Symbol: AHR
• Gene ID (NCBI): 196
• RRID: AB_3086275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35869
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)