AIFM2/ FSP1 Polyclonal antibody

• 

  WB analysis using 20886-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20886-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20886-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of L02 using 20886-1-AP

  IP result of anti-AIFM2/ FSP1 (IP:20886-1-AP, 4ug; Detection:20886-1-AP 1:3000) with L02 cells lysate 1040 ug.

• 

  IHC staining of mouse liver using 20886-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 20886-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 20886-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using AIFM2/ FSP1 antibody (20886-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

AIFM2/ FSP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 20886-1-AP

Publications(170)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

AMID, AIFM2, FSP1, EC:1.6.5.-, Apoptosis-inducing factor homologous mitochondrion-associated inducer of death

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HeLa cells, rat liver tissue, HepG2 cells, PC-12 ceslls
• Positive IP detected in: L02 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 7 publications below
• WB: See 150 publications below
• IHC: See 19 publications below
• IF: See 24 publications below
• IP: See 4 publications below
• CoIP: See 2 publications below

Product Information

20886-1-AP targets AIFM2/ FSP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13412

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_2878756
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis-associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis-Inducing Factor), a mitochondrion-associated enzyme that relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; ALDH7A1 protects against ferroptosis by generating membrane NADH and regulating FSP1; Authors - Jia-Shu Yang
human	WB	Cell Res; Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression; Authors - Shiqiao Qiu
human	WB	Nature; The CoQ oxidoreductase FSP1 acts parallel to GPX4 to inhibit ferroptosis.; Authors - Kirill Bersuker
human	WB,IHC	Drug Resist Updat; Upregulation of CoQ shifts ferroptosis dependence from GPX4 to FSP1 in acquired radioresistance; Authors - Xu Lin
human	WB	Protein Cell; Proteomic analysis of ferroptosis pathways reveals a role of CEPT1 in suppressing ferroptosis; Authors - Xiaoguang Liu
mouse	WB	Nat Commun; Targeting ferroptosis by poly(acrylic) acid coated Mn3O4 nanoparticles alleviates acute liver injury; Authors - Xinyi Shan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Selin (Verified Customer) (03-14-2024)

We've been having problems to identify this protein, but luckily this antibody worked perfectly.

• Applications: Western Blot