AIFM2/ FSP1 Polyclonal antibody

• 

  WB analysis using 20886-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20886-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20886-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of L02 using 20886-1-AP

  IP result of anti-AIFM2/ FSP1 (IP:20886-1-AP, 4ug; Detection:20886-1-AP 1:3000) with L02 cells lysate 1040 ug.

• 

  IHC staining of mouse liver using 20886-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 20886-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20886-1-AP (AIFM2/ FSP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 20886-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using AIFM2/ FSP1 antibody (20886-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

AIFM2/ FSP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 20886-1-AP

Publications(172)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

AMID, AIFM2, FSP1, EC:1.6.5.-, Apoptosis-inducing factor homologous mitochondrion-associated inducer of death

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HeLa cells, rat liver tissue, HepG2 cells, PC-12 ceslls
• Positive IP detected in: L02 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 7 publications below
• WB: See 152 publications below
• IHC: See 20 publications below
• IF: See 25 publications below
• IP: See 4 publications below
• CoIP: See 2 publications below

Product Information

20886-1-AP targets AIFM2/ FSP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13412

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_2878756
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis-associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis-Inducing Factor), a mitochondrion-associated enzyme that relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; ALDH7A1 protects against ferroptosis by generating membrane NADH and regulating FSP1; Authors - Jia-Shu Yang
human	WB	Cell Res; Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression; Authors - Shiqiao Qiu
human	WB	Nature; The CoQ oxidoreductase FSP1 acts parallel to GPX4 to inhibit ferroptosis.; Authors - Kirill Bersuker
human	WB,IHC	Drug Resist Updat; Upregulation of CoQ shifts ferroptosis dependence from GPX4 to FSP1 in acquired radioresistance; Authors - Xu Lin
human	WB	Protein Cell; Proteomic analysis of ferroptosis pathways reveals a role of CEPT1 in suppressing ferroptosis; Authors - Xiaoguang Liu
mouse	WB	Nat Commun; Targeting ferroptosis by poly(acrylic) acid coated Mn3O4 nanoparticles alleviates acute liver injury; Authors - Xinyi Shan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Jelan (Verified Customer) (10-31-2025)

For the protein AIFM2/FSP1, it itself is an inhibition of FSP1 sensitizes cancer cells to ferroptosis and suppresses tumor growth and it is associated with cell death. we use it in our western blots to see if our cell lysates from our experiment to see if they over or under express ferroptosis.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Melanoma cell lines

FH

Selin (Verified Customer) (03-14-2024)

We've been having problems to identify this protein, but luckily this antibody worked perfectly.

• Applications: Western Blot