ALAS2 Polyclonal antibody

• 

  WB analysis using 30539-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30539-1-AP (ALAS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 30539-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using ALAS2 antibody (30539-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ALAS2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30539-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

ALAS-E, ALASE, ALAS E, ALAS 2, 5-aminolevulinic acid synthase 2

---

Tested Applications

• Positive WB detected in: K-562 cells, NIH/3T3 cells, mouse brain tissue, mouse heart tissue
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30539-1-AP targets ALAS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30308

  Product name: Recombinant human ALAS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 502-574 aa of BC030230

  Sequence: LLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA

• Full Name: aminolevulinate, delta-, synthase 2
• Calculated Molecular Weight: 587 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC030230
• Gene Symbol: ALAS2
• Gene ID (NCBI): 212
• RRID: AB_3086355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22557
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The heme biosynthetic pathway begins from delta aminolevulinic acid synthase (ALAS) catalyzing the condensation of glycine and succinyl-CoA to delta aminolevulinic acid (ALA) in the mitochondria. ALAS is coded by two genes: ALAS1 and ALAS2 . ALAS1 is ubiquitously expressed in all cells, and the negative feedback is regulated by the heme pool; however, ALAS2 is specifically expressed only in erythroid cells.