Tested Applications
| Positive WB detected in | K-562 cells, mouse spleen tissue, mouse testis tissue, rat spleen tissue, rat testis tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:150-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13951-1-AP targets ALDH1A2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5062 Product name: Recombinant human ALDH1A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 181-481 aa of BC030589 Sequence: GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS Predict reactive species |
| Full Name | aldehyde dehydrogenase 1 family, member A2 |
| Calculated Molecular Weight | 518 aa, 57 kDa |
| Observed Molecular Weight | 53-57 kDa |
| GenBank Accession Number | BC030589 |
| Gene Symbol | ALDH1A2 |
| Gene ID (NCBI) | 8854 |
| RRID | AB_2224033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O94788 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ALDH1A2(aldehyde dehydrogenase family 1 member A2) is also named as RALDH2(retinal dehydrogenase 2) and belongs to the aldehyde dehydrogenase family. It is a cytosolic homotetramer(56.7 kDa subunits) exhibiting complex expression patterns throughout embryonic development. ALDH1A2 plays a role in retinoid metabolism during embryonic development where it is considered to be the major retinoic acid-synthesizing enzyme during early embryogenesis(PMID:20735668). Its expression is reduced in primary prostate tumors compared with normal prostate tissue suggested that it is normally expressed in the epithelial compartment of prostate tissue(PMID:16166285).It has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ALDH1A2 antibody 13951-1-AP | Download protocol |
| IHC protocol for ALDH1A2 antibody 13951-1-AP | Download protocol |
| IP protocol for ALDH1A2 antibody 13951-1-AP | Download protocol |
| WB protocol for ALDH1A2 antibody 13951-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ALDH1A2 polyclonal antibody (Cat# 13951-1-AP) has 18 citations across journals including Neuron, Cell Chemical Biology, Cell Reports, Clinical and Translational Medicine, Hemasphere, Cell Death & Differentiation, eLife, iScience, Cell Signaling, International Journal of Molecular Sciences, Journal of Lipid Research, Journal of Nutritional Biochemistry, Biology of Reproduction, American Journal of Cancer Research, Fluids Barriers CNS, PLoS ONE, and bioRxiv. Research fields span neuroscience, oncology, reproductive biology, lipid metabolism, renal fibrosis, and ferroptosis.
| Species | Application | Title |
|---|---|---|
Neuron A gain-of-function Retsat variant from high-altitude adaptation promotes myelination via a neuronal dihydroretinoic acid-RXR-γ pathway | ||
Hemasphere Upregulation of ALDH1 as an adaptive epigenetic response to anthracyclines in acute myeloid leukemia. | ||
Cell Chem Biol Inter- and intra-tumoral ALDH1 heterogeneity in breast cancer identifies therapeutic opportunities for ALDH1A-specific inhibitors. | ||
Clin Transl Med Melatonin inhibits lipid accumulation to repress prostate cancer progression by mediating the epigenetic modification of CES1. | ||
Cell Rep Tracing Tumor Evolution in Sarcoma Reveals Clonal Origin of Advanced Metastasis. | ||
Fluids Barriers CNS Postnatal meningeal CSF transport is primarily mediated by the arachnoid and pia maters and is not altered after intraventricular hemorrhage-posthemorrhagic hydrocephalus |
