ALDH1B1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85426-4-RR (same clone as 85426-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85426-4-RR (ALDH1B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85426-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 85426-4-RR (same clone as 85426-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ALDH1B1 antibody (85426-4-RR, Clone: 242944D1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85426-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85426-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85426-4-RR against Human ALDH1B1 were performed. The affinity constant is below 1 pM.

ALDH1B1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85426-4-PBS

Clone No.242944D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

242944D1, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase X, mitochondrial, ALDH5, ALDHX

---

Product Information

85426-4-PBS targets ALDH1B1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7144

  Product name: Recombinant human ALDH1B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 168-517 aa of BC001619

  Sequence: FCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS

• Full Name: aldehyde dehydrogenase 1 family, member B1
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC001619
• Gene Symbol: ALDH1B1
• Gene ID (NCBI): 219
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30837
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112). This antibody is specific to ALDH1B1.