Product Information
20753-1-PBS targets ALG6 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14176 Product name: Recombinant human ALG6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-125 aa of BC001253 Sequence: GLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIYI Predict reactive species |
| Full Name | asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) |
| Calculated Molecular Weight | 507 aa, 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC001253 |
| Gene Symbol | ALG6 |
| Gene ID (NCBI) | 29929 |
| RRID | AB_10693678 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y672 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ALG6 gene encodes an α-1,3-glucosyltransferase used to add the first glucose to the immature lipid-linked oligosaccharide (LLO) precursor. ALG6 has 14 transmembrane helices and two long loops (EL1 and EL4) that forms a large, hydrophilic cavity facing the ER lumen and a groove-shaped cavity facing the lipid bilayer (PMID: 21334936).



