Filter: AllWBIHC

WB analysis using 12292-1-AP (same clone as 12292-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 12292-1-AP (ALKBH3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
WB analysis of mouse kidney using 12292-1-AP (same clone as 12292-1-PBS)
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12292-1-AP (ALKBH3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
WB analysis of mouse heart using 12292-1-AP (same clone as 12292-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 12292-1-AP (ALKBH3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
WB analysis using 12292-1-AP (same clone as 12292-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 12292-1-AP (ALKBH3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 12292-1-AP (same clone as 12292-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer using 12292-1-AP (ALKBH3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
IHC staining of human prostate cancer using 12292-1-AP (same clone as 12292-1-PBS)
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12292-1-AP (ALKBH3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 12292-1-AP (same clone as 12292-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12292-1-AP (ALKBH3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 12292-1-AP (same clone as 12292-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12292-1-AP (ALKBH3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
IHC staining of rat stomach using 12292-1-AP (same clone as 12292-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 12292-1-AP (ALKBH3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 12292-1-AP (same clone as 12292-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 12292-1-AP (ALKBH3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 12292-1-AP (same clone as 12292-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 12292-1-AP (ALKBH3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 12292-1-AP (same clone as 12292-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 12292-1-AP (ALKBH3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12292-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

ALKBH3 Polyclonal antibody, PBS Only

ALKBH3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12292-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

12292-1-PBS targets ALKBH3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2982 Product name: Recombinant human ALKBH3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 148-286 aa of BC015155 Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW Predict reactive species
Full Name	alkB, alkylation repair homolog 3 (E. coli)
Calculated Molecular Weight	286 aa, 33 kDa
Observed Molecular Weight	22-25 kDa, 33kDa
GenBank Accession Number	BC015155
Gene Symbol	ALKBH3
Gene ID (NCBI)	221120
RRID	AB_11125161
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96Q83
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

ALKBH3, also named as ABH3 and DEPC-1, is a dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). It has a strong preference for single-stranded. ALKBH3 is requires molecular oxygen, alpha-ketoglutarate and iron. This gene has some isoforms with MW 19-25 kDa and 33 kDa.