Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26501-1-AP targets AMBN in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24129 Product name: Recombinant human AMBN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 286-335 aa of BC106931 Sequence: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN Predict reactive species |
| Full Name | ameloblastin (enamel matrix protein) |
| Calculated Molecular Weight | 447 aa, 48 kDa |
| Observed Molecular Weight | 48-55 kDa |
| GenBank Accession Number | BC106931 |
| Gene Symbol | AMBN |
| Gene ID (NCBI) | 258 |
| RRID | AB_3669542 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NP70 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AMBN(Ameloblastin), the gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect. It is expected to be located in the Vesicles, in addition localized to the Nucleoplasm, which is enriched in brain, and located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel. The molecular weight of AMBN is 48 kDa. It also has phosphorylation modification.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMBN antibody 26501-1-AP | Download protocol |
| WB protocol for AMBN antibody 26501-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



