AMY2B Monoclonal antibody, PBS Only

• 

  WB analysis using 68474-1-Ig (same clone as 68474-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68474-1-Ig (AMY2B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68474-1-PBS in a different storage buffer formulation.

AMY2B Monoclonal Antibody for WB, ELISA

Cat No. 68474-1-PBS

Clone No.2E5G2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

Synonyms

Amylase Alpha, Amylase, alpha, 1,4-alpha-D-glucan glucanohydrolase 2B, 2E5G2, Alpha amylase

---

Product Information

68474-1-PBS targets AMY2B in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3260

  Product name: Recombinant human AMY2B protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 160-511 aa of BC011179

  Sequence: SGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

• Full Name: amylase, alpha 2B (pancreatic)
• Calculated Molecular Weight: 511 aa, 58 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC011179
• Gene Symbol: AMY2B
• Gene ID (NCBI): 280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P19961
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012).