Product Information
15815-1-AP targets ANAPC13 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8601 Product name: Recombinant human ANAPC13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC005398 Sequence: MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN Predict reactive species |
Full Name | anaphase promoting complex subunit 13 |
Calculated Molecular Weight | 74 aa, 9 kDa |
GenBank Accession Number | BC005398 |
Gene Symbol | ANAPC13 |
Gene ID (NCBI) | 25847 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BS18 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |