Angiopoietin 2 Polyclonal antibody

• 

  WB analysis using 24613-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24613-1-AP (Angiopoietin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 24613-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using Angiopoietin 2 antibody (24613-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of PC-12 using 24613-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-12 cells using Angiopoietin 2 antibody (24613-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Angiopoietin 2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 24613-1-AP

Publications(30)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ANGPT2, AGPT 2, AGPT2, ANG 2, ANG2

---

Tested Applications

• Positive WB detected in: HUVEC cells, HeLa cells, HepG2 cells, K-562 cells
• Positive IF/ICC detected in: PC-12 cells, A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 22 publications below
• IHC: See 8 publications below
• IF: See 7 publications below

Product Information

24613-1-AP targets Angiopoietin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17938

  Product name: Recombinant human ANGPT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 357-443 aa of BC126200

  Sequence: NEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTG

• Full Name: angiopoietin 2
• Calculated Molecular Weight: 496 aa, 57 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC126200
• Gene Symbol: Angiopoietin 2
• Gene ID (NCBI): 285
• RRID: AB_2879639
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15123
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiopoietin-2 (Ang2) is a growth factor belonging to the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway, one of the main pathways involved in angiogenesis. Angiopoietin-2 was identified through a cDNA library screening, shortly after the identification of angiopoietin-1. Angiopoietin-2, is a natural antagonist for Tie2 that disrupts in vivo angiogenesis. In adult mice and humans, Angiopoietin-2 is expressed only at sites of vascular remodeling. Angiopoietin-2 has also been found to be highly expressed in diverse tumor cells and plays an important role in tumor angiogenesis and inflammation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Mol Ther Nucleic Acids; Tumor-Derived EV-Encapsulated miR-181b-5p Induces Angiogenesis to Foster Tumorigenesis and Metastasis of ESCC.; Authors - Ying Wang
human	WB	J Med Chem; Discovery of Novel Small-Molecule Antiangiogenesis Agents to Treat Diabetic Retinopathy.; Authors - Donghwa Kim
human	WB	Int J Mol Sci; MiR-29a Curbs Hepatocellular Carcinoma Incidence via Targeting of HIF-1α and ANGPT2.; Authors - Ying-Hsien Huang
mouse	WB,IF	Exp Mol Med; Akt1-dependent expression of angiopoietin 1 and 2 in vascular smooth muscle cells leads to vascular stabilization; Authors - Jung Min Ha
human	IHC	Front Oncol; MAPK-RAP1A Signaling Enriched in Hepatocellular Carcinoma Is Associated With Favorable Tumor-Infiltrating Immune Cells and Clinical Prognosis.; Authors - Hailin Li
human	IF	Biomed Pharmacother; Diosmetin inhibits tumor development and block tumor angiogenesis in skin cancer.; Authors - Jawun Choi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Angie (Verified Customer) (07-25-2025)

The antibody detected several bands at dilution of 1:2000 incubated at room temperature for 2 hours followed by secondary antibody donkey-anti-rabbit (Alexa Fluor 800) at 1:20000 dilution, incubated 1 hour at room temperature.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: A549

Angiopoietin 2 Antibody Western Blot validation (1:2000 dilution) in A549 (Cat no:24613-1-AP)

FH

Marine (Verified Customer) (07-01-2025)

It is not specific, it binds at different molecular weight on the ladder

• Applications: Western Blot
• Primary Antibody Dilution: 1/500 and 1/1000
• Cell Tissue Type: Tumoral cells, endothelial cells, mouse fibroblasts

Angiopoietin 2 Antibody Western Blot validation (1/500 and 1/1000 dilution) in Tumoral cells, endothelial cells, mouse fibroblasts (Cat no:24613-1-AP)