ANGPTL3 Recombinant monoclonal antibody

• 

  WB analysis using 86193-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86193-1-RR (ANGPTL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human hepatocellular cancer using 86193-1-RR

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 86193-1-RR (ANGPTL3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocellular cancer using 86193-1-RR

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 86193-1-RR (ANGPTL3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 86193-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 86193-1-RR (ANGPTL3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 86193-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 86193-1-RR (ANGPTL3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse kidney using 86193-1-RR

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse kidney tissue using ANGPTL3 antibody (86193-1-RR, Clone: 250808F7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of mouse kidney using 86193-1-RR

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse kidney tissue using ANGPTL3 antibody (86193-1-RR, Clone: 250808F7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 86193-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86193-1-RR against Human ANGPTL3 were performed. The affinity constant is below 1 pM.

ANGPTL3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-Fro, ELISA

Cat No. 86193-1-RR

Clone No.250808F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-Fro, ELISA

Synonyms

ANG-5, Angiopoietin like protein 3, Angiopoietin related protein 3, Angiopoietin-5, Angiopoietin-like protein 3

---

Tested Applications

• Positive WB detected in: HepG2 cells, A375 cells, HEK-293 cells, HuH-7 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human hepatocellular cancer, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-Fro detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86193-1-RR targets ANGPTL3 in WB, IHC, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2573

  Product name: Recombinant human ANGPTL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-460 aa of BC058287

  Sequence: GIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE

• Full Name: angiopoietin-like 3
• Calculated Molecular Weight: 460 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC058287
• Gene Symbol: ANGPTL3
• Gene ID (NCBI): 27329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5C1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANGPTL3 belongs to the angiopoietin-like protein family. ANGPTL3 is mainly synthesized by liver cells and is notably expressed in kidney podocytes. Accumulating evidences have revealed that ANGPTL3 plays a critical role in both biological processes, such as lipid metabolism, angiogenesis and haematopoietic function and pathological changes, including atherosclerosis, carcinogenesis, nephrotic syndrome, diabetes, liver diseases and so on. Thus, ANGPTL3 may serve as a potential biomarker in these diseases.