ANGPTL3 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86193-1-RR (same clone as 86193-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86193-1-RR (ANGPTL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86193-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02294-1

  Serum of sixteen individual healthy human donors was measured. The ANGPTL3 concentration of detected samples was determined to be 66.13 ng/mL with a range of 21.12-106.91 ng/mL.

• 

  Sandwich ELISA standard curve of MP02294-1

  Sandwich ELISA standard curve of MP02294-1, Human ANGPTL3 Recombinant Matched Antibody Pair - PBS only. 86193-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag2573. 86193-1-PBS was HRP conjugated as the detection antibody. Range: 3.13-100 ng/mL.

• 

  IHC staining of human hepatocellular cancer using 86193-1-RR (same clone as 86193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 86193-1-RR (ANGPTL3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86193-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocellular cancer using 86193-1-RR (same clone as 86193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 86193-1-RR (ANGPTL3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86193-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 86193-1-RR (same clone as 86193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 86193-1-RR (ANGPTL3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86193-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 86193-1-RR (same clone as 86193-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 86193-1-RR (ANGPTL3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86193-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 86193-1-RR (same clone as 86193-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse kidney tissue using ANGPTL3 antibody (86193-1-RR, Clone: 250808F7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86193-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 86193-1-RR (same clone as 86193-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse kidney tissue using ANGPTL3 antibody (86193-1-RR, Clone: 250808F7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86193-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02294-1

  The mean ANGPTL3 concentration was determined to be 14.8 ng/mL in human serum.

• 

  Cytometric bead array standard curve of MP02294-1

  Cytometric bead array standard curve of MP02294-1, ANGPTL3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86193-2-PBS. Detection antibody: 86193-1-PBS. Standard: Ag2573. Range: 1.563-200 ng/mL.

• 

  Affinity and Kinetic Characterization of 86193-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86193-1-RR against Human ANGPTL3 were performed. The affinity constant is below 1 pM.

ANGPTL3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-Fro, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86193-1-PBS

Clone No.250808F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-Fro, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

ANG-5, Angiopoietin like protein 3, Angiopoietin related protein 3, Angiopoietin-5, Angiopoietin-like protein 3

---

Product Information

86193-1-PBS targets ANGPTL3 as part of a matched antibody pair:

MP02294-1: 86193-2-PBS capture and 86193-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2573

  Product name: Recombinant human ANGPTL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-460 aa of BC058287

  Sequence: GIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE

• Full Name: angiopoietin-like 3
• Calculated Molecular Weight: 460 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC058287
• Gene Symbol: ANGPTL3
• Gene ID (NCBI): 27329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5C1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ANGPTL3 belongs to the angiopoietin-like protein family. ANGPTL3 is mainly synthesized by liver cells and is notably expressed in kidney podocytes. Accumulating evidences have revealed that ANGPTL3 plays a critical role in both biological processes, such as lipid metabolism, angiogenesis and haematopoietic function and pathological changes, including atherosclerosis, carcinogenesis, nephrotic syndrome, diabetes, liver diseases and so on. Thus, ANGPTL3 may serve as a potential biomarker in these diseases.