Product Information
68766-1-PBS targets ANKRD13B as part of a matched antibody pair:
MP50125-1: 68766-1-PBS capture and 68766-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22725 Product name: Recombinant human ANKRD13B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 433-493 aa of BC032554 Sequence: FGNLNGCDEPVPSVRGSPSSETPSPGSDSSSVSSSSSTTSCRGCEISPALFEAPRGYSMMG Predict reactive species |
| Full Name | ankyrin repeat domain 13B |
| Calculated Molecular Weight | 626 aa, 70 kDa |
| GenBank Accession Number | BC032554 |
| Gene Symbol | ANKRD13B |
| Gene ID (NCBI) | 124930 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q86YJ7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

