ANKRD54 Monoclonal antibody, PBS Only

• 

  WB analysis using 68388-1-Ig (same clone as 68388-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68388-1-Ig (ANKRD54 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68388-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 68388-1-Ig (same clone as 68388-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 68388-1-Ig (ANKRD54 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68388-1-PBS in a different storage buffer formulation.

ANKRD54 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68388-1-PBS

Clone No.1E9A9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, Indirect ELISA

Synonyms

ANKRD54, ankyrin repeat domain 54

---

Product Information

68388-1-PBS targets ANKRD54 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22772

  Product name: Recombinant human ANKRD54 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 201-300 aa of BC066909

  Sequence: RVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR

• Full Name: ankyrin repeat domain 54
• Calculated Molecular Weight: 300 aa, 33 kDa
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: BC066909
• Gene Symbol: ANKRD54
• Gene ID (NCBI): 129138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6NXT1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ankyrin repeat domain 54 (ANKRD54)/Liar is a nuclear-cytoplasmic shuttling adaptor that interacts with Lyn, Btk, Txk, and HCLS1. Activation of PKC kinases promoted nuclear export and phosphorylation of Ankrd54, and increased interaction and cytoplasmic co-localization with Lyn.