• Featured Product
  • KD/KO Validated

TMEM16A/DOG1 Polyclonal antibody

TMEM16A/DOG1 Polyclonal Antibody for IHC, IF-P, ELISA
Cat No. 12652-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

IHC, IF-P, IP, ELISA

ANO1, Anoctamin 1, Anoctamin-1, Discovered on gastrointestinal stromal tumors protein 1, DOG1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lung cancer tissue, mouse pancreas tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12652-1-AP targets TMEM16A/DOG1 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3320

Product name: Recombinant human ANO1,DOG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 541-712 aa of BC027590

Sequence: LVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQEIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL

Predict reactive species
Full Name anoctamin 1, calcium activated chloride channel
Calculated Molecular Weight986 aa, 114 kDa
Observed Molecular Weight114 kDa
GenBank Accession NumberBC027590
Gene Symbol TMEM16A
Gene ID (NCBI) 55107
RRIDAB_2722560
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ5XXA6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANO1 also named as DOG1, ORAOV2, TAOS2 and TMEM16A, acts as a calcium-activated chloride channel. It is required for normal tracheal development. ANO1 (or DOG1) is used as an aid in the identification and diagnosis of gastrointestinal stromal tumors (GIST) within the context of an antibody panel, the patient's clinical history, and other diagnostic tests evaluated by a qualified pathologist. The immunogen is the C-terminal of ANO1. This antibody can recognize isoform1 and isoform2 of human ANO1.

Protocols

Product Specific Protocols
IF protocol for TMEM16A/DOG1 antibody 12652-1-APDownload protocol
IHC protocol for TMEM16A/DOG1 antibody 12652-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Elife

Gq activity- and β-arrestin-1 scaffolding-mediated ADGRG2/CFTR coupling are required for male fertility.

Authors - Dao-Lai Zhang
ratIHC

Biomed Pharmacother

Calcium-activated chloride channel is involved in the onset of diarrhea triggered by EGFR tyrosine kinase inhibitor treatment in rats.

Authors - Yumi Harada
mouseIHC

Am J Physiol Gastrointest Liver Physiol

miR-128 participates in the pathogenesis of chronic constipation by regulating the p38α/M-CSF inflammatory signaling pathway.

Authors - Yuntian Hong
ratIF

PLoS One

Anoctamin-1 in the juvenile rat urinary bladder.

Authors - Dominika A Bijos

Cell Death Dis

Dual role of Ca2+-activated Cl- channel transmembrane member 16A in lipopolysaccharide-induced intestinal epithelial barrier dysfunction in vitro.

Authors - Jingru Sui
humanIHC

Front Oncol

Primary extra-gastrointestinal stromal tumor of retroperitoneum: Clinicopathologic characteristics and prognosis of six cases

Authors - Jiaxin Lin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Shabana (Verified Customer) (07-23-2025)

I have used Tmem16a (Ano1) for IF using mouse colonic tissues. There were major concerns about this antibody in giving compromised staining, this antibody from Proteintech gave good staining in the gut tissues at 1:100 dilution. The IHC results are very promising, and I would use this to look for the expression of Tmem16a in brain and blood-brain-barrier dysfunction. Will also try for western blotting.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Gut
FH

Shihab (Verified Customer) (09-17-2021)

I have used this for immunofluorescent stainings in a certain tissue type (cannot disclose) and despite ANO1 antibodies being notorious for such stainings (we have found only 1 other to work properly), this antibody gave very encouraging results on the first attempt at staining. With further optimisation, we should be able to get a decent staining pattern. Very impressed. I will also be trying this in various other applications. Very promising antibody.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
Loading...
||
New chat Able
正在加载,请稍候...