AP2B1 Monoclonal antibody

• 

  WB analysis using 68349-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68349-1-Ig (AP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 68349-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 68349-1-Ig (AP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68349-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68349-1-Ig (AP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 68349-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AP2B1 antibody (68349-1-Ig, Clone: 1A3B6 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HeLa using 68349-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AP2B1 antibody (68349-1-Ig, Clone: 1A3B6 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CoraLite®594-Phalloidin (red).

AP2B1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68349-1-Ig

Clone No.1A3B6

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat, Rabbit, Pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ADTB2, AP 2 complex subunit beta, AP105B, AP2 BETA, AP2B1, Beta 2 adaptin, Beta adaptin, CLAPB1, DKFZp781K0743

---

Tested Applications

• Positive WB detected in: pig cerebellum tissue, HeLa cells, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

68349-1-Ig targets AP2B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples.

• Tested Reactivity: Human, Mouse, Rat, Rabbit, Pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8264

  Product name: Recombinant human AP2B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 598-951 aa of BC006201

  Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

• Full Name: adaptor-related protein complex 2, beta 1 subunit
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 100-115 kDa
• GenBank Accession Number: BC006201
• Gene Symbol: AP2B1
• Gene ID (NCBI): 163
• RRID: AB_3085072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63010
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Mol Life Sci; ELAPOR1 mediated vesicle traffic is required for acrosome biogenesis and male fertility in mice.; Authors - Runze Ding