AP2B1 Monoclonal antibody

AP2B1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68349-1-Ig
Clone No.1A3B6

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat, Rabbit, Pig

Applications

WB, IHC, IF/ICC, ELISA

ADTB2, AP 2 complex subunit beta, AP105B, AP2 BETA, AP2B1, Beta 2 adaptin, Beta adaptin, CLAPB1, DKFZp781K0743

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig cerebellum tissue, HeLa cells, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue
Positive IHC detected inrat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68349-1-Ig targets AP2B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples.

Tested Reactivity Human, Mouse, Rat, Rabbit, Pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8264

Product name: Recombinant human AP2B1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 598-951 aa of BC006201

Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

Predict reactive species
Full Name adaptor-related protein complex 2, beta 1 subunit
Calculated Molecular Weight 105 kDa
Observed Molecular Weight100-115 kDa
GenBank Accession NumberBC006201
Gene Symbol AP2B1
Gene ID (NCBI) 163
RRIDAB_3085072
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP63010
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis.

Protocols

Product Specific Protocols
IF protocol for AP2B1 antibody 68349-1-IgDownload protocol
IHC protocol for AP2B1 antibody 68349-1-IgDownload protocol
WB protocol for AP2B1 antibody 68349-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...