AP2B1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68349-1-Ig (same clone as 68349-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68349-1-Ig (AP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68349-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68349-1-Ig (same clone as 68349-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 68349-1-Ig (AP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68349-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68349-1-Ig (same clone as 68349-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68349-1-Ig (AP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68349-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 68349-1-Ig (same clone as 68349-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68349-1-Ig (AP2B1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68349-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 68349-1-Ig (same clone as 68349-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68349-1-Ig (AP2B1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68349-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68349-1-Ig (same clone as 68349-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AP2B1 antibody (68349-1-Ig, Clone: 1A3B6 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68349-1-PBS in a different storage buffer formulation.

AP2B1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68349-1-PBS

Clone No.1A3B6

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat, Rabbit, Pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ADTB2, AP 2 complex subunit beta, AP105B, AP2 BETA, AP2B1, Beta 2 adaptin, Beta adaptin, CLAPB1, DKFZp781K0743

---

Product Information

68349-1-PBS targets AP2B1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples.

• Tested Reactivity: Human, Mouse, Rat, Rabbit, Pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8264

  Product name: Recombinant human AP2B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 598-951 aa of BC006201

  Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

• Full Name: adaptor-related protein complex 2, beta 1 subunit
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 100-115 kDa
• GenBank Accession Number: BC006201
• Gene Symbol: AP2B1
• Gene ID (NCBI): 163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63010
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis.