AP3S2 Recombinant monoclonal antibody

• 

  WB analysis using 86795-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86795-1-RR (AP3S2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86795-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86795-1-RR (AP3S2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86795-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86795-1-RR against Human AP3S2 were performed. The affinity constant is below 1 pM.

AP3S2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86795-1-RR

Clone No.251741C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Adaptor-related protein complex 3 subunit sigma-2, AP 3 complex subunit sigma 2, AP 3 complex subunit sigma 3B, AP-3 complex subunit sigma-2, AP-3 complex subunit sigma-3B

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, HepG2 cells, mouse testis tissue, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86795-1-RR targets AP3S2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7565

  Product name: Recombinant human AP3S2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC002785

  Sequence: MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV

• Full Name: adaptor-related protein complex 3, sigma 2 subunit
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC002785
• Gene Symbol: AP3S2
• Gene ID (NCBI): 10239
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P59780
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP3S2 is a 22-kDa protein that belongs to the adaptor complexes small subunit family. AP3S2 is a subunit of the AP-3 complex which is associated with the Golgi region as well as more peripheral structures. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-3 complex is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2).