Tested Applications
| Positive IHC detected in | mouse brain tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27202-1-AP targets AP4S1 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25661 Product name: Recombinant human AP4S1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 5-98 aa of BC001259 Sequence: FLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYRQYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRV Predict reactive species |
| Full Name | adaptor-related protein complex 4, sigma 1 subunit |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC001259 |
| Gene Symbol | AP4S1 |
| Gene ID (NCBI) | 11154 |
| RRID | AB_3085936 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y587 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AP4S1 antibody 27202-1-AP | Download protocol |
| IHC protocol for AP4S1 antibody 27202-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











