Tested Applications
| Positive WB detected in | BxPC-3 cells, HT-1080 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20812-1-AP targets APBA3 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14771 Product name: Recombinant human APBA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 341-412 aa of BC008338 Sequence: IAQAIGQAFAAAYSQFLRESGIDPSQVGVHPSPGARHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVES Predict reactive species |
| Full Name | amyloid beta (A4) precursor protein-binding, family A, member 3 |
| Calculated Molecular Weight | 575 aa, 61 kDa |
| Observed Molecular Weight | 70-75 kDa |
| GenBank Accession Number | BC008338 |
| Gene Symbol | APBA3 |
| Gene ID (NCBI) | 9546 |
| RRID | AB_3669349 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O96018 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The APBA (MINT) family is a family of adaptor proteins composed of APBA1 (MINT1), APBA2 (MINT2), and APBA3 (MINT3). These proteins are involved in neuronal protein transport and synaptic function. APBA3 plays an essential role in mediating the transport of APP from the TGN to the plasma membrane (PMID: 24410826).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for APBA3 antibody 20812-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

