APBB3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• APBB3 Polyclonal antibody (12051-1-AP)

APBB3 Polyclonal Antibody for WB, ELISA

Cat No. 12051-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

APBB3, FE65L2, Protein Fe65 like 2, SRA

• 

  WB analysis of human plasma using 12051-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 12051-1-AP (APBB3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12051-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 12051-1-AP (APBB3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for APBB3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human plasma

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12051-1-AP targets APBB3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2681

  Product name: Recombinant human APBB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 187-486 aa of BC013158

  Sequence: HSLIHCQPLVHIRVWGVGSSKGRDRDFAFVASDKDSCMLKCHVFRCDVPAKAIASALHGLCAQILSERVEVSGDASCCSPDPISPEDLPRQVELLDAVSQAAQKYEALYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSLLDAFRLKPSLLHMP

• Full Name: amyloid beta (A4) precursor protein-binding, family B, member 3
• Calculated Molecular Weight: 486 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC013158
• Gene Symbol: APBB3
• Gene ID (NCBI): 10307
• RRID: AB_3085387
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95704
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

APBB3 is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP.

Publications

What published studies show

The APBB3 Polyclonal antibody (Cat# 12051-1-AP) has 1 citation. It was cited in J Nanobiotechnology (Impact Factor: 15), in a study on pro-efferocytic macrophage membrane biomimetic nanoparticles for synergistic atherosclerosis treatment via competition effect. The research field encompasses nanobiotechnology, macrophage biology, and cardiovascular disease therapeutics. The antibody was applied in Western Blot (WB) with mouse species.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Nanobiotechnology; Pro-efferocytic macrophage membrane biomimetic nanoparticles for the synergistic treatment of atherosclerosis via competition effect; Authors - Xuan Sha