APOD Polyclonal antibody

• 

  WB analysis of HepG2 using 10520-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10520-1-AP (APOD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human plasma using 10520-1-AP

  human serum were subjected to SDS PAGE followed by western blot with 10520-1-AP (APOD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 10520-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10520-1-AP (APOD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 10520-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10520-1-AP (APOD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

APOD Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10520-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Apo D, Apo-D, apolipoprotein D

---

Tested Applications

• Positive WB detected in: human serum tissue, HepG2 cells, human plasma
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:800-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 4 publications below

Product Information

10520-1-AP targets APOD in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0812

  Product name: Recombinant human APOD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-189 aa of BC007402

  Sequence: FGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

• Full Name: apolipoprotein D
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 21-33 kDa
• GenBank Accession Number: BC007402
• Gene Symbol: APOD
• Gene ID (NCBI): 347
• RRID: AB_2057977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05090
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apolipoprotein D (ApoD) is a member of the lipocalin superfamily of ligand transporters, and has been implicated in the transport of small hydrophobic molecules. ApoD is also a component of plasma high-density lipoproteins (HDL). Alteration of ApoD expression has been linked to multiple neurological disorders, including Alzheimer's disease.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Neuropathol Appl Neurobiol; Apolipoprotein D: a potential biomarker for cerebral amyloid angiopathy.; Authors - H Bea Kuiperij
human	WB	Clin Proteomics; Integration of transcriptome and proteome profiles in placenta accreta reveals trophoblast over-migration as the underlying pathogenesis.; Authors - Na Li ; KD Validated
human	WB,IHC	Biomarkers; Apolipoprotein D as a novel marker in human end-stage heart failure: a preliminary study.; Authors - Wei Ying-Jie YJ
human	IHC	Front Immunol; A novel necroptosis-related gene index for predicting prognosis and a cold tumor immune microenvironment in stomach adenocarcinoma; Authors - Muhammad Khan
human	IHC	Comput Struct Biotechnol J; Uncovering the potential of APOD as a biomarker in gastric cancer: A retrospective and multi-center study; Authors - Zisong Wang