• Featured Product
  • KD/KO Validated

APOD Polyclonal antibody

APOD Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10520-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Apo D, Apo-D, apolipoprotein D

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman serum tissue, HepG2 cells, human plasma
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:800-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10520-1-AP targets APOD in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0812

Product name: Recombinant human APOD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 15-189 aa of BC007402

Sequence: FGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

Predict reactive species
Full Name apolipoprotein D
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 21-33 kDa
GenBank Accession NumberBC007402
Gene Symbol APOD
Gene ID (NCBI) 347
RRIDAB_2057977
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05090
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apolipoprotein D (ApoD) is a member of the lipocalin superfamily of ligand transporters, and has been implicated in the transport of small hydrophobic molecules. ApoD is also a component of plasma high-density lipoproteins (HDL). Alteration of ApoD expression has been linked to multiple neurological disorders, including Alzheimer's disease.

Protocols

Product Specific Protocols
IHC protocol for APOD antibody 10520-1-APDownload protocol
WB protocol for APOD antibody 10520-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Neuropathol Appl Neurobiol

Apolipoprotein D: a potential biomarker for cerebral amyloid angiopathy.

Authors - H Bea Kuiperij
humanWB

Clin Proteomics

Integration of transcriptome and proteome profiles in placenta accreta reveals trophoblast over-migration as the underlying pathogenesis.

Authors - Na Li
  • KD Validated
humanWB,IHC

Biomarkers

Apolipoprotein D as a novel marker in human end-stage heart failure: a preliminary study.

Authors - Wei Ying-Jie YJ
humanIHC

Front Immunol

A novel necroptosis-related gene index for predicting prognosis and a cold tumor immune microenvironment in stomach adenocarcinoma

Authors - Muhammad Khan
humanIHC

Comput Struct Biotechnol J

Uncovering the potential of APOD as a biomarker in gastric cancer: A retrospective and multi-center study

Authors - Zisong Wang
Loading...
||
New chat Able
正在加载,请稍候...