APTX Polyclonal antibody

• 

  WB analysis of HEK-293T using 26747-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 26747-1-AP (APTX Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 26747-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26747-1-AP (APTX Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293T using 26747-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 26747-1-AP (APTX Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 26747-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 26747-1-AP (APTX antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 26747-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 26747-1-AP (APTX antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 26747-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using APTX antibody (26747-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

APTX Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26747-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Forkhead-associated domain histidine triad-like protein, FHA-HIT, EC:3.6.1.71, AXA1, AXA 1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HepG2 cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26747-1-AP targets APTX in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24945

  Product name: Recombinant human APTX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC104881

  Sequence: MMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQLKAECNKGYVKVKQVGVNPTSIDSVVIGKDQEVKLQPGQVLHMVNELYPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSNSGQCSVPLKKGKDAPIKKESL

• Full Name: aprataxin
• Calculated Molecular Weight: 342 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC104881
• Gene Symbol: APTX
• Gene ID (NCBI): 54840
• RRID: AB_2880620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z2E3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

APTX, also named as Aprataxin, is a nuclear protein, present in both the nucleoplasm and the nucleolus, which is a member of the histidine triad (HIT) superfamily. APTX is involved in DNA single-strand break repair, mediating protein-protein interactions with molecules responding to DNA damage. APTX contains three conserved domains: an N-terminal forkhead-associated (FHA) domain which mediates protein-protein interactions, a HIT domain that is similar to Hint, and a C-terminal zinc finger domain. Loss of function mutations in APTX, the gene encoding for Aprataxin, destabilize the Aprataxin protein and result in a rare neurological disorder known as ataxia-oculomotor apraxia, characterized by abnormal movements of the head and eyes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Cell Rep; Base-excision repair pathway regulates transcription-replication conflicts in pancreatic ductal adenocarcinoma; Authors - Fan Meng