• Featured Product
  • KD/KO Validated

Amphiregulin Polyclonal antibody

Amphiregulin Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA
Cat No. 16036-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

AREG, AR, AREGB, Colorectum cell-derived growth factor, CRDGF

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, MCF-7 cells, Calu-1 cells, HepG2 cells, L02 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman stomach cancer tissue, human colon tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon cancer tissue, mouse embryo tissue, human placenta tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16036-1-AP targets Amphiregulin in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8907

Product name: Recombinant human AREG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-252 aa of BC009799

Sequence: AGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA

Predict reactive species
Full Name amphiregulin
Calculated Molecular Weight 252 aa, 28 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC009799
Gene Symbol Amphiregulin/AREG
Gene ID (NCBI) 374
RRIDAB_2227602
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15514
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Amphiregulin (AREG) is one of the ligands of the epidermal growth factor receptor (EGFR). AREG plays a central role in mammary gland development and branching morphogenesis in organs and is expressed both in physiological and in cancerous tissues. The AREG protein is synthesized as a 252-amino acid transmembrane precursor, pro-AREG. At the plasma membrane, pro-AREG is subjected to sequential proteolytic cleavages within its ectodomain and is then released as the soluble AREG protein. Depending on the cell type and microenvironment, AREG can be produced in multiple cellular and mature forms using alternative pro-AREG cleavage sites and glycosylation motifs. Post-translastional modfications of 50-kDa pro-AREG produces a major soluble 43-kDa form, 28-, 26-, 16-kDa membrane anchored forms, and soluble 21-, 19-, and 9-kDa forms (PMID: 9642297).

Protocols

Product Specific Protocols
WB protocol for Amphiregulin antibody 16036-1-APDownload protocol
IHC protocol for Amphiregulin antibody 16036-1-APDownload protocol
IF protocol for Amphiregulin antibody 16036-1-APDownload protocol
IP protocol for Amphiregulin antibody 16036-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Res

CD317 Activates EGFR by Regulating Its Association with Lipid Rafts.

Authors - Guizhong Zhang
humanIP

Proc Natl Acad Sci U S A

AhR controls redox homeostasis and shapes the tumor microenvironment in BRCA1-associated breast cancer.

Authors - Shawn P Kubli
mouseWB

Cell Commun Signal

BMAL1 ameliorates type 2 diabetes-induced cognitive impairment via AREG upregulation and PI3K/Akt/GSK-3β pathway activation

Authors - Jialu Xu
humanWB

Cell Biosci

TPM2 attenuates progression of prostate cancer by blocking PDLIM7-mediated nuclear translocation of YAP1

Authors - Zonglong Wu
humanWB,IF

Oncogene

The EGF receptor ligand amphiregulin controls cell division via FoxM1.

Authors - S W Stoll
humanWB,IP,IHC

Aging Cell

Targeting amphiregulin (AREG) derived from senescent stromal cells diminishes cancer resistance and averts programmed cell death 1 ligand (PD-L1)-mediated immunosuppression.

Authors - Qixia Xu
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...