• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Amphiregulin Polyclonal antibody

Amphiregulin Polyclonal Antibody for IF-P
Cat No. CL488-16036

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

amphiregulin, AR, AREG, AREGB, CRDGF, SDGF

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman colon cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16036 targets Amphiregulin in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8907

Product name: Recombinant human AREG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-252 aa of BC009799

Sequence: AGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA

Predict reactive species
Full Name amphiregulin
Calculated Molecular Weight 252 aa, 28 kDa
GenBank Accession NumberBC009799
Gene Symbol Amphiregulin/AREG
Gene ID (NCBI) 374
RRIDAB_2919129
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15514
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Amphiregulin (AREG) is one of the ligands of the epidermal growth factor receptor (EGFR). AREG plays a central role in mammary gland development and branching morphogenesis in organs and is expressed both in physiological and in cancerous tissues. The AREG protein is synthesized as a 252-amino acid transmembrane precursor, pro-AREG. At the plasma membrane, pro-AREG is subjected to sequential proteolytic cleavages within its ectodomain and is then released as the soluble AREG protein. Depending on the cell type and microenvironment, AREG can be produced in multiple cellular and mature forms using alternative pro-AREG cleavage sites and glycosylation motifs. Post-translastional modfications of 50-kDa pro-AREG produces a major soluble 43-kDa form, 28-, 26-, 16-kDa membrane anchored forms, and soluble 21-, 19-, and 9-kDa forms (PMID: 9642297).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Amphiregulin antibody CL488-16036Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...