ARHGAP19 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP00937-1

  HL-60 cell lysate was measured. The human ARHGAP19 concentration of detected samples was determined to be 11.94 ng/mL (based on a 4.3 mg/mL extract load) in HL-60 cell lysate.

• 

  Sandwich ELISA standard curve of MP00937-1

  Sandwich ELISA standard curve of MP00937-1, Human ARHGAP19 Recombinant Matched Antibody Pair - PBS only. 84029-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag34671. 84029-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL

• 

  Cytometric bead array standard curve of MP00937-1

  Cytometric bead array standard curve of MP00937-1, ARHGAP19 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84029-2-PBS. Detection antibody: 84029-1-PBS. Standard: Ag34671. Range:1.563-200 ng/mL.

ARHGAP19 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 84029-1-PBS

Clone No.241210B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

Rho GTPase-activating protein 19, Rho-type GTPase-activating protein 19

---

Product Information

84029-1-PBS targets ARHGAP19 as part of a matched antibody pair:

MP00937-1: 84029-2-PBS capture and 84029-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34671

  Product name: Recombinant human ARHGAP19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 388-494 aa of BC114490

  Sequence: KKKQLIRQFNKQSLTQTPGREPSTSQVQKRARSRSFSGLIKRKVLGNQMMSEKKKKNPTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL

• Full Name: Rho GTPase activating protein 19
• GenBank Accession Number: BC114490
• Gene Symbol: ARHGAP19
• Gene ID (NCBI): 84986
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14CB8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.