GRAF Polyclonal antibody

GRAF Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 17747-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, CoIP, ELISA

ARHGAP26, OPHN1L, Oligophrenin-1-like protein, Oligophrenin 1 like protein, KIAA0621

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, human brain tissue, mouse thymus tissue
Positive IP detected inHepG2 cells
Positive IHC detected inmouse brain tissue, human heart tissue, human liver tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17747-1-AP targets GRAF in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12008

Product name: Recombinant human ARHGAP26 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 403-759 aa of BC068555

Sequence: RGINEQGLYRIVGVNSRVQKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL

Predict reactive species
Full Name Rho GTPase activating protein 26
Calculated Molecular Weight 759 aa, 86 kDa
Observed Molecular Weight 92 kDa
GenBank Accession NumberBC068555
Gene Symbol ARHGAP26
Gene ID (NCBI) 23092
RRIDAB_2059284
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UNA1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GTPase Regulator Associated with Focal Adhesion Kinase (GRAF), also known as Rho GTPase activating protein 26 (ARHGAP26) , is a GTPase-activating protein and inhibits the activity of Rho GTPases by promoting the hydrolytic ability of Rho GTPases. GRAF enhances the hydrolysis of GTPases and converts GTPases from an active form to an inactive form, thereby inhibiting signaling transduction. Deletion and mutation of GRAF can lead to promyelocytic leukemia, suggesting tumor suppressive activity of GRAF. GRAF was downregulated in glioblastoma and associated with cell proliferation and migration (PMID: 10908648, PMID: 17611651, PMID: 31004081). It has been reported that there are three splicing mutants of GRAF, namely GRAF1a (92 kDa),GRAF1b (86 kDa) and GRAF1c (75-82 kDa), and GRAF1b and GRAF1c are the major GRAF1 isoforms in adult brain, whereas GRAF1a is abundant in neonates(PMID: 35624318, PMID: 30626696).

Protocols

Product Specific Protocols
IHC protocol for GRAF antibody 17747-1-APDownload protocol
IP protocol for GRAF antibody 17747-1-APDownload protocol
WB protocol for GRAF antibody 17747-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Neurol

Rho GTPase-activating protein 10 (ARHGAP10/GRAF2) is a novel autoantibody target in patients with autoimmune encephalitis

Authors - Sven Jarius
humanWB

Brain Res

Deficiency of NEAT1 prevented MPP+-induced inflammatory response, oxidative stress and apoptosis in dopaminergic SK-N-SH neuroblastoma cells via miR-1277-5p/ARHGAP26 axis.

Authors - Shufang Zhou
humanWB,IHC,CoIP

Cell Death Dis

CEMIP, acting as a scaffold protein for bridging GRAF1 and MIB1, promotes colorectal cancer metastasis via activating CDC42/MAPK pathway

Authors - Guojie Xu
humanWB,IHC

World J Surg Oncol

Prognostic value of circadian rhythm-associated genes in breast cancer

Authors - Ling Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Cicek (Verified Customer) (06-11-2024)

I used this antibody on mouse neurons, iPSCs and iNeurons with Western blotting, using beta-actin as positive control. There were specific bands at 90 kDa mark for iPSCs and iNeurons, but not for mouse neurons. It was highly expressed in iNeurons. There were unspecific bands at the 70 kDa mark for all samples.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
Loading...
||
New chat Able
正在加载,请稍候...