ARHGEF18 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse testis using 11243-1-AP (same clone as 11243-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 11243-1-AP (ARHGEF18 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11243-1-AP (same clone as 11243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11243-1-AP (ARHGEF18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 11243-1-AP (same clone as 11243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11243-1-AP (ARHGEF18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 11243-1-AP (same clone as 11243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11243-1-AP (ARHGEF18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11243-1-AP (same clone as 11243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11243-1-AP (ARHGEF18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 11243-1-AP (same clone as 11243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11243-1-AP (ARHGEF18 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 11243-1-AP (same clone as 11243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11243-1-AP (ARHGEF18 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11243-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 11243-1-AP (same clone as 11243-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using ARHGEF18 antibody (11243-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11243-1-PBS in a different storage buffer formulation.

ARHGEF18 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11243-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

114 kDa Rho-specific guanine nucleotide exchange factor, KIAA0521, p114 Rho GEF, P114 RhoGEF, p114RhoGEF

---

Product Information

11243-1-PBS targets ARHGEF18 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1749

  Product name: Recombinant human ARHGEF18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC014994

  Sequence: MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG

• Full Name: rho/rac guanine nucleotide exchange factor (GEF) 18
• Calculated Molecular Weight: 131 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC014994
• Gene Symbol: ARHGEF18
• Gene ID (NCBI): 23370
• RRID: AB_2877753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZSZ5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.