Tested Applications
| Positive WB detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25060-1-AP targets ARRDC3 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18717 Product name: Recombinant human ARRDC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-122 aa of BC053619 Sequence: DCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTP Predict reactive species |
| Full Name | arrestin domain containing 3 |
| Calculated Molecular Weight | 414 aa, 46 kDa |
| Observed Molecular Weight | 46 kDa |
| GenBank Accession Number | BC053619 |
| Gene Symbol | ARRDC3 |
| Gene ID (NCBI) | 57561 |
| RRID | AB_2879878 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96B67 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARRDC3 (Arrestin domain-containing protein 3) is an adaptor protein involved in modulating the cell-surface abundance of adrenergic receptors and likely other G protein-coupled receptors. It participates in NEDD4-dependent ubiquitination, endocytosis, and subsequent degradation of activated ADRB2. ARRDC3 may recruit NEDD4 to ADRB2; alternatively, it may act as an adaptor that contributes to endosomal targeting of ADRB2 rather than serving as a primary mediator for NEDD4 recruitment to this receptor (PMID: 20559325; 21982743; 23208550).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ARRDC3 antibody 25060-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ARRDC3 Polyclonal antibody (Cat# 25060-1-AP) has 1 total citation. It appears in Biochemical and Biophysical Research Communications (2016), where it was used in Western blot to study the ARRDC3/ITGB4 pathway. The research field encompasses prostate cancer progression, androgen receptor–regulated microRNA (miR-182-5p) signaling, and G protein-coupled receptor trafficking.
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun Androgen receptor regulated microRNA miR-182-5p promotes prostate cancer progression by targeting the ARRDC3/ITGB4 pathway.
|
