ARSE Polyclonal antibody

• 

  IHC staining of mouse liver using 31522-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31522-1-AP (ARSE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 31522-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31522-1-AP (ARSE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 31522-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ARSE antibody (31522-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

ARSE Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 31522-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

CDPXR, CDPX1, CDPX, ASE, Arylsulfatase E

---

Tested Applications

• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31522-1-AP targets ARSE in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24371

  Product name: Recombinant human ARSE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 524-567 aa of BC130438

  Sequence: HILTPASEPVFYQVMERVQQAVWEHQRTLSPVPLQLDRLGNIWR

• Full Name: arylsulfatase E (chondrodysplasia punctata 1)
• GenBank Accession Number: BC130438
• Gene Symbol: ARSE
• Gene ID (NCBI): 415
• RRID: AB_3670019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P51690
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARSE (arylsulfatase E), is a member of the sulfatase family. This enzyme is glycosylated post-translationally. Sulfatases, including ARSE, are essential for the correct composition of the bone and cartilage matrix.