ASB12 Polyclonal antibody

• 

  WB analysis using 33262-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33262-1-AP (ASB12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

ASB12 Polyclonal Antibody for WB, ELISA

Cat No. 33262-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Ankyrin repeat and SOCS box protein 12, ASB-12

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, mouse testis tissue, rat skeletal musle tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33262-1-AP targets ASB12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36991

  Product name: Recombinant human ASB12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 12-161 aa of BC069436

  Sequence: LLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERYKRFINSRSGWGVPGTPLRLAASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAGASPGGSIYNNCSPVLTAARDGAVAILQELLDHGAEANVKAK

• Full Name: ankyrin repeat and SOCS box-containing 12
• Calculated Molecular Weight: 309 aa, 34 kDa/318 aa, 35 kDa
• Observed Molecular Weight: 34,39 kDa
• GenBank Accession Number: BC069436
• Gene Symbol: ASB12
• Gene ID (NCBI): 142689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WXK4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ankyrin repeat and SOCS box (ASB) family is composed of 18 proteins from ASB1 to ASB18 and belongs to the suppressor of cytokine signaling (SOCS) box protein superfamily. ASB family proteins interact with Cul5-Rbx2 to form E3 Ub ligases and play significant roles via a ubiquitination-mediated pathway (PMID: 16325183). The calculated molecular weight of ASB12 in mice or rat was 34 kda. ASB12 may be ubiquitinated, resulting in an increase in the observed molecular quantity.