ASH2L Polyclonal antibody, PBS Only

• 

  WB analysis of COS-7 using 12331-1-AP (same clone as 12331-1-PBS)

  COS-7 cells were subjected to SDS PAGE followed by western blot with 12331-1-AP (ASH2L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12331-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 12331-1-AP (same clone as 12331-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 12331-1-AP (ASH2L Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12331-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 12331-1-AP (same clone as 12331-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 12331-1-AP (ASH2L Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12331-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 12331-1-AP (same clone as 12331-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 12331-1-AP (ASH2L Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12331-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 12331-1-AP (same clone as 12331-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 12331-1-AP (ASH2L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12331-1-PBS in a different storage buffer formulation.

• 

  IP experiment of COLO 320 using 12331-1-AP (same clone as 12331-1-PBS)

  IP result of anti-ASH2L (IP:12331-1-AP, 4ug; Detection:12331-1-AP 1:500) with COLO 320 cells lysate 2000ug. This data was developed using the same antibody clone with 12331-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12331-1-AP (same clone as 12331-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12331-1-AP (ASH2L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12331-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12331-1-AP (same clone as 12331-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12331-1-AP (ASH2L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12331-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ASH2L Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12331-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, monkey

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12331-1-PBS targets ASH2L in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, monkey samples.

• Tested Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3008

  Product name: Recombinant human ASH2L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 234-534 aa of BC015936

  Sequence: HGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP

• Full Name: ash2 (absent, small, or homeotic)-like (Drosophila)
• Calculated Molecular Weight: 628 aa, 69 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC015936
• Gene Symbol: ASH2L
• Gene ID (NCBI): 9070
• RRID: AB_2059837
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBL3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.