ASIC3 Polyclonal antibody

• 

  WB analysis using 28093-1-AP

  Mouse kidney tissue lysate was subjected to SDS PAGE followed by western blot with 28093-1-AP (ASIC3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ASIC3 Polyclonal Antibody for WB, ELISA

Cat No. 28093-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ACCN3, Acid sensing ion channel 3, Acid-sensing ion channel 3, Amiloride-sensitive cation channel 3, DRASIC

---

Tested Applications

• Positive WB detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28093-1-AP targets ASIC3 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26092

  Product name: Recombinant human ASIC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 107-175 aa of NM_004769

  Sequence: MLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPEN

• Full Name: amiloride-sensitive cation channel 3
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 59-70 kDa
• GenBank Accession Number: NM_004769
• Gene Symbol: ACCN3
• Gene ID (NCBI): 9311
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHC3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.