ATG3 Polyclonal antibody

• 

  WB analysis using 11262-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11262-2-AP (ATG3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 11262-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11262-2-AP (ATG3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 11262-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11262-2-AP (ATG3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 11262-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using ATG3 antibody (11262-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

ATG3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11262-2-AP

Publications(26)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Autophagy-related protein 3, ATG 3, APG3-like, APG3L, APG3 LIKE

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells, Jurkat cells, K-562 cells, THP-1 cells, PC-12 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 24 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

11262-2-AP targets ATG3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1785

  Product name: Recombinant human ATG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-314 aa of BC024221

  Sequence: MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

• Full Name: ATG3 autophagy related 3 homolog (S. cerevisiae)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC024221
• Gene Symbol: ATG3
• Gene ID (NCBI): 64422
• RRID: AB_2059234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NT62
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Autophagy is a lysosome-dependent conserved catabolic process in response to various stresses, such as oxidative stress and ischemia, for the degradation and recycling of aged or dysfunctional intracellular components and damaged organelles. A large group of autophagy-related genes (ATGs) have been identifed as essential drivers in diferent stages of autophagy. Autophagy-related 3 (ATG3), one of the autophagyrelated gene family members, serves as an E2-like enzyme contributing to the conjugation of microtubule-associated protein light chain 3 (LC3) to lipid phosphotidylethanolamine (PE). ATG3 plays a signifcant role in the regulation of autophagy, viability, and death.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; Cytoplasmic fragment of CD147 generated by regulated intramembrane proteolysis contributes to HCC by promoting autophagy.; Authors - Bo Wu
pig	WB	Chemosphere; Genome-wide transcriptional profiling and functional analysis reveal miR-330-MAPK15 axis involving in cellular responses to deoxynivalenol exposure.; Authors - Haifei Wang
mouse	WB	Front Cell Dev Biol; Aquaporin-8 transports hydrogen peroxide to regulate granulosa cell autophagy; Authors - Binbin Huang
mouse	WB	Front Immunol; Toxoplasma gondii CDPK3 Controls the Intracellular Proliferation of Parasites in Macrophages.; Authors - Minmin Wu
human	WB	Oncotarget; Upregulation of the lncRNA Meg3 induces autophagy to inhibit tumorigenesis and progression of epithelial ovarian carcinoma by regulating activity of ATG3.; Authors - Yin-Ling Xiu
mouse	WB	Ecotoxicol Environ Saf; Exposure to DEHP induces testis toxicity and injury through the ROS/mTOR/NLRP3 signaling pathway in immature rats.; Authors - Yifan Hong