ATG3 Polyclonal antibody

ATG3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 11262-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Autophagy-related protein 3, ATG 3, APG3-like, APG3L, APG3 LIKE

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, HeLa cells, Jurkat cells, K-562 cells, THP-1 cells, PC-12 cells
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11262-2-AP targets ATG3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1785

Product name: Recombinant human ATG3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-314 aa of BC024221

Sequence: MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

Predict reactive species
Full Name ATG3 autophagy related 3 homolog (S. cerevisiae)
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 36-40 kDa
GenBank Accession NumberBC024221
Gene Symbol ATG3
Gene ID (NCBI) 64422
RRIDAB_2059234
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NT62
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Autophagy is a lysosome-dependent conserved catabolic process in response to various stresses, such as oxidative stress and ischemia, for the degradation and recycling of aged or dysfunctional intracellular components and damaged organelles. A large group of autophagy-related genes (ATGs) have been identifed as essential drivers in diferent stages of autophagy. Autophagy-related 3 (ATG3), one of the autophagyrelated gene family members, serves as an E2-like enzyme contributing to the conjugation of microtubule-associated protein light chain 3 (LC3) to lipid phosphotidylethanolamine (PE). ATG3 plays a signifcant role in the regulation of autophagy, viability, and death.

Protocols

Product Specific Protocols
IF protocol for ATG3 antibody 11262-2-APDownload protocol
IHC protocol for ATG3 antibody 11262-2-APDownload protocol
WB protocol for ATG3 antibody 11262-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Death Dis

Cytoplasmic fragment of CD147 generated by regulated intramembrane proteolysis contributes to HCC by promoting autophagy.

Authors - Bo Wu
pigWB

Chemosphere

Genome-wide transcriptional profiling and functional analysis reveal miR-330-MAPK15 axis involving in cellular responses to deoxynivalenol exposure.

Authors - Haifei Wang
mouseWB

Front Cell Dev Biol

Aquaporin-8 transports hydrogen peroxide to regulate granulosa cell autophagy

Authors - Binbin Huang
mouseWB

Front Immunol

Toxoplasma gondii CDPK3 Controls the Intracellular Proliferation of Parasites in Macrophages.

Authors - Minmin Wu
humanWB

Oncotarget

Upregulation of the lncRNA Meg3 induces autophagy to inhibit tumorigenesis and progression of epithelial ovarian carcinoma by regulating activity of ATG3.

Authors - Yin-Ling Xiu
mouseWB

Ecotoxicol Environ Saf

Exposure to DEHP induces testis toxicity and injury through the ROS/mTOR/NLRP3 signaling pathway in immature rats.

Authors - Yifan Hong
Loading...
||
New chat Able
正在加载,请稍候...