CoraLite® Plus 488-conjugated ATG3 Polyclonal antibody

ATG3 Polyclonal Antibody for IF/ICC
Cat No. CL488-11262

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

APG3, APG3 LIKE, APG3L, ATG3, Autophagy related protein 3, DKFZp564M1178, FLJ22125, hApg3, PC3 96, Protein PC3 96

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11262 targets ATG3 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1785

Product name: Recombinant human ATG3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-314 aa of BC024221

Sequence: MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

Predict reactive species
Full Name ATG3 autophagy related 3 homolog (S. cerevisiae)
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 36-40 kDa
GenBank Accession NumberBC024221
Gene Symbol ATG3
Gene ID (NCBI) 64422
RRIDAB_3672490
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NT62
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Autophagy is a lysosome-dependent conserved catabolic process in response to various stresses, such as oxidative stress and ischemia, for the degradation and recycling of aged or dysfunctional intracellular components and damaged organelles. A large group of autophagy-related genes (ATGs) have been identifed as essential drivers in diferent stages of autophagy. Autophagy-related 3 (ATG3), one of the autophagyrelated gene family members, serves as an E2-like enzyme contributing to the conjugation of microtubule-associated protein light chain 3 (LC3) to lipid phosphotidylethanolamine (PE). ATG3 plays a signifcant role in the regulation of autophagy, viability, and death.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ATG3 antibody CL488-11262Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...