Tested Applications
| Positive WB detected in | HEK-293 cells, A549 cells, HeLa cells, HepG2 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27156-1-AP targets ATM in WB, IHC, IF, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25909 Product name: Recombinant human ATM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2407-2709 aa of NM_000051 Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG Predict reactive species |
| Full Name | ataxia telangiectasia mutated |
| Observed Molecular Weight | 310-350 kDa |
| GenBank Accession Number | NM_000051 |
| Gene Symbol | ATM |
| Gene ID (NCBI) | 472 |
| RRID | AB_2880780 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13315 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ATM antibody 27156-1-AP | Download protocol |
| IHC protocol for ATM antibody 27156-1-AP | Download protocol |
| IP protocol for ATM antibody 27156-1-AP | Download protocol |
| WB protocol for ATM antibody 27156-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ATM antibody (catalog 27156-1-AP) has 60 citations. These appear in journals including Cancer Research, Nature Communications, Science Translational Medicine, Science Advances, Cell Death & Differentiation, Cell Death & Disease, Cell Reports, Oncogene, EBioMedicine, and Advanced Science. The associated research fields center on DNA damage response and repair (ATM/CHK1, homologous recombination, non-homologous end joining), cancer biology, radioresistance, and related signaling in glioma, leukemia, and solid tumors, with most studies using Western blot.
| Species | Application | Title |
|---|---|---|
Cancer Res PGC-1α degradation suppresses mitochondrial biogenesis to confer radiation resistance in glioma | ||
Nat Commun SARS-CoV-2 N protein-induced Dicer, XPO5, SRSF3, and hnRNPA3 downregulation causes pneumonia | ||
Exp Mol Med The long non-coding RNA-encoded microprotein MKKS3 drives colorectal cancer chemoresistance | ||
J Adv Res An interpretable artificial intelligence framework for designing synthetic lethality-based anti-cancer combination therapies | ||
Sci Transl Med Guanosine diphosphate-mannose suppresses homologous recombination repair and potentiates antitumor immunity in triple-negative breast cancer | ||
Acta Pharm Sin B Honokiol alleviated neurodegeneration by reducing oxidative stress and improving mitochondrial function in mutant SOD1 cellular and mouse models of amyotrophic lateral sclerosis |
Reviews
What customers say
The product received a 5-star rating from a single reviewer who used it at a 1:1000 dilution for Western Blot. The reviewer reported excellent band quality, indicating strong specificity and sensitivity in their application. Overall, the feedback is positive, with no issues or concerns raised.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Md Asad (Verified Customer) (05-07-2026) | Excellent bands in my western blot.
|
