Product Information
83785-6-PBS targets ATOX1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag18460 Product name: Recombinant human ATOX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC112248 Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE Predict reactive species |
Full Name | ATX1 antioxidant protein 1 homolog (yeast) |
Calculated Molecular Weight | 68 aa, 8 kDa |
Observed Molecular Weight | 7 kDa |
GenBank Accession Number | BC112248 |
Gene Symbol | ATOX1 |
Gene ID (NCBI) | 475 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | O00244 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Antioxidant 1 (ATOX1) is a copper chaperone to regulate copper homeostasis in cell. In the cytosol, ATOX1 always binds to copper and transfer to ATPase proteins in the trans-Golgi network, thereby promoting copper supply to various copper-dependent oxidereductases matured within the secretory vesicles (PMID: 28294521). Also, the protein could protect cells against oxidative damage and the expression levels of ATOX1 may help to the inflammatory response and antioxidant defense,even to modulate response to the cancer (PMID: 27472369). ATOX1 plays an important role in the physiology of the human central nervous system ,and it's highly expressed in the cerebral cortex and hippocampus (PMID: 30545441). Either cytosol or nucleus location of ATOX1 has been reported in different literations, which may be associated with cell status (PMID: 24445997; 31317143).