Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IP detected in | rat brain tissue |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
25727-1-AP targets ATP1A3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22842 Product name: Recombinant human ATP1A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC015566 Sequence: MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARD Predict reactive species |
Full Name | ATPase, Na+/K+ transporting, alpha 3 polypeptide |
Calculated Molecular Weight | 1013 aa, 112 kDa |
Observed Molecular Weight | 110-113 kDa |
GenBank Accession Number | BC015566 |
Gene Symbol | ATP1A3 |
Gene ID (NCBI) | 478 |
RRID | AB_3085820 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P13637 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP1A3 participates in the catalyticing hydrolysis of ATP and the exchanging of sodium and potassium ions across plasma membrane. The catalyticing activity mode is ATP + H2O + Na+(In) + K+(Out) = ADP + phosphate + Na+(Out) + K+(In). It has been published that the neurologic disorders rapid-onset dystonia-parkionsonism (RDP), alternating hemiplegia of childhood (ACH) and CAPOS syndrome (cerebellar ataxia, areflexia, pes cavus, optic atrophy and sensorineural hearing loss) are all related with the mutation of ATP1A3. There are other reports suggest that early life epilepsy and episodic apnea revealing are potentially associated with the mutation of ATP1A3 as a result of impairment of Na/K homeostasis. This antibody is generated against the C-terminal region (665-1013aa) of ATP1A3 and detects the band around 100-113 kDa in SDS-PAGE.(PMID: 30097153, 20301294, 29922587)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ATP1A3 antibody 25727-1-AP | Download protocol |
IHC protocol for ATP1A3 antibody 25727-1-AP | Download protocol |
IF protocol for ATP1A3 antibody 25727-1-AP | Download protocol |
IP protocol for ATP1A3 antibody 25727-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Commun Biol PEX3 promotes regenerative repair after myocardial injury in mice through facilitating plasma membrane localization of ITGB3 | ||
Dis Model Mech HBS1L deficiency causes retinal dystrophy in a child and a mouse model associated with defective development of photoreceptor cells |